Free account: auto-import unlimited products to unlimited Shopify stores, 5 Signal asks, and 5 open picks from today's board.

S
Visit store
Open research tabsPro

Pro only · 2 tabs · storefront + best-sellers

sallyklein.ca

SALLY KLEIN — Traffic, Sales & Best SellersADAEAFAGAI+214

Possible dropshipping match, with 2,719 products in the crawled catalogue.

Store catalogue last scanned 1 day ago

Counts and rankings are estimates — not exact sales or revenue. How the numbers work

Est. sales range
$25 – $46

Estimated monthly

Est. yearly sales
$297 – $552

Estimated annualized

Products detected
2,719

~2,719 products on this store the last time we crawled it — not a live inventory count

Store age
11 mo

Store Leads estimate

Platform confidence90%Store originCHFirst crawledAug 12, 2026Last crawled listingSep 27, 2026Last crawledSep 26, 2026

Why we flagged this store

App-fingerprint evidence: each dropship-exclusive app detected on the store adds weighted points. This is a signal match — not a confirmation of how the merchant fulfils orders.

This store is a candidate.

Parcel Panel / ParcelWILL

Package tracking

+3

Likely best-selling products

Products

Operator network

Sibling domains Store Leads groups with this merchant (estimated cluster). When one store in a network starts winning, its siblings are worth watching.

Localised storefronts

The same catalogue served on a country or language domain — a merchant running these is already selling in more than one market.

sallyklein.chsallyklein.be

Other domains pointing here

Domains that redirect or canonicalise to this store — same shop, another name.

www.sallyklein.besallyklein.be

GoogleMetaAdvertising signals

Google Shopping, Meta Ad Library, keyword visibility and Ads Transparency signals — estimated visibility, never exact ad spend.

Store overview

Classification, markets, ranking and product detail from Store Leads — estimates, not a complete audit.

Classification

Categories

Apparel › Men's Clothing

Features

Shopify New Customer AccountsShopify Online Store 2.0New Shopify Checkout (2022)Contact PageTracking or ReturnsTracking PageHas Blog

Markets & shipping

Ships to / sells in

ADAEAFAGAIALAMAOARATAUAWAXAZBABBBDBEBFBGBHBIBJBLBMBNBQBRBSBTBWBYBZCACCCFCGCHCICKCLCMCNCOCRCWCXCYCZDEDJDKDMDODZECEEEGERESETFIFJFOFRGAGBGDGEGFGGGHGIGLGMGNGPGQGRGSGTGWGYHKHNHRHTHUIDIEILIMINIOIQISITJEJMJOJPKEKGKHKIKMKNKWKYKZLALBLCLILKLRLSLTLULVLYMAMCMEMFMGMLMMMNMOMQMRMSMTMUMVMWMXMYMZNANCNENFNGNINLNONPNRNUNZOMPAPEPFPGPHPKPLPMPNPTPYQARORSRURWSASBSCSDSESGSISJSKSLSMSNSOSRSSSTSVSXTCTDTFTGTHTJTKTLTMTNTOTRTTTVTWUAUGUMUSUYUZVCVNVUWFWSXKYEYTZAZMZW
Est. yearly sales
$297 – $552
estimated annualized
Shopify rank
#2,336,277
global
Outranks
42.4%
of Shopify stores
Overall rank
#10,420,690
all platforms
Outranks
29.6%
of all tracked stores
Monthly app spend
$13
est.
Related domains
1
Variants
2,136
Vendors
1
Collections
45
Avg. price (USD)
$54.98
Min price (USD)
$5.78
Max price (USD)
$132.36
Location
Geneva, Europe
Subregion
Western Europe
Theme
impact (Maestrooo)
shape · vUnknown · $400 theme
Avg. product weight
832 g
estimated — shipping cost proxy
Newest product
Oct 18, 2025
last product Store Leads saw published
Storefront languages
FR
site language
Est. store created
Oct 10, 2025
SL last updated
Sep 17, 2026

Platform stack

Social profiles, installed apps and technologies Store Leads associates with this storefront.

Installed apps (6)

Infinite Options: Product opt

Infinite Options: Product opt

product variants · product bundles

XO Insert Code

XO Insert Code

product content · storefronts - other

CWILL Order Tracking

CWILL Order Tracking

order tracking · shipping

Product Reviews

Product Reviews

product reviews

Transcy: AI Language Translate

Transcy: AI Language Translate

currency and translation · geolocation

Conversion Bear Trust Badges

Conversion Bear Trust Badges

badges and icons · design elements - other

Technologies detected

Estimated technographics — not a complete audit.

Apple PayArriveCloudflareCloudflare CDNGoogle Ads PixelGoogle AdsenseGoogle PayGoogle Tag ManagerParcelPanelPayPal Express CheckoutVimeoYouTube Player

Quick answers about SALLY KLEIN

Figures are estimates from public data — never exact sales or revenue.

Is SALLY KLEIN a dropshipping store?
Possibly. sallyklein.ca is a possible dropshipping match on WHAT Shipping?. We found Parcel Panel / ParcelWILL installed. The match comes from the apps the store runs, not proof of how it fulfils orders.
How much does SALLY KLEIN sell?
An estimated $25 – $46 in sales a month ($297 – $552 a year). It is a range estimated from public data, not reported revenue.
What does SALLY KLEIN sell?
sallyklein.ca lists about 2,719 products in Apparel › Men's Clothing. Its likely best sellers are Collier Bodega Box, Bague Ajustable Pierre Ronde plaquée or 18K avec zircon and Bracelet Giada Bellini Finition Argent.
What apps does SALLY KLEIN use?
WHAT Shipping? found 6 apps on sallyklein.ca, including Infinite Options: Product opt, XO Insert Code, CWILL Order Tracking, Product Reviews and Transcy: AI Language Translate.
How old is SALLY KLEIN?
sallyklein.ca was created around Oct 10, 2025, about 11 mo ago, by Store Leads' estimate.