Free account: auto-import unlimited products to unlimited Shopify stores, 5 Signal asks, and 5 open picks from today's board.

V
Visit store
Open research tabsPro

Pro only · 2 tabs · storefront + best-sellers

velthentic.com

Velthentic — Traffic, Sales & Best SellersADAEAFAGAI+214

Shopify Plus

Strong dropshipping match, with estimated 5K–10K monthly traffic, 723 products in the crawled catalogue.

High-quality products, swift shipping, user-friendly website, and dedicated customer service. Discover fashion, electronics, household items, and gifts at un...

Store catalogue last scanned 3 days ago

Counts and rankings are estimates — not exact sales or revenue. How the numbers work

Est. monthly traffic
5K–10K

Estimated range — subscribers see the point estimate

Est. sales range
$92K – $172K

Estimated monthly

Est. yearly sales
$1M – $2M

Estimated annualized

Products detected
723

~723 products on this store the last time we crawled it — not a live inventory count

Store age
2 yr 8 mo

Store Leads estimate

Platform confidence90%Store originCYPages / visit3.7First crawledJun 26, 2026Last crawled listingSep 26, 2026Last crawledSep 24, 2026

Why we flagged this store

App-fingerprint evidence: each dropship-exclusive app detected on the store adds weighted points. This is a signal match — not a confirmation of how the merchant fulfils orders.

This store is a strong match.

DSers

Dropship sourcing / fulfilment

+5

Parcel Panel / ParcelWILL

Package tracking

+3

17TRACK

Package tracking

+3

Likely best-selling products

Products

Operator network

Sibling domains Store Leads groups with this merchant (estimated cluster). When one store in a network starts winning, its siblings are worth watching.

This merchant appears to run 1 other store. Their best-ranked storefront is www.velthentic.com.

Other domains pointing here

Domains that redirect or canonicalise to this store — same shop, another name.

kitchape.myshopify.com

Domain & market

WHOIS domain age is free. Search-demand data comes from the same paid enrichment as SEO depth.

Domain age

2 yrs 254 days

Registered: 30 Dec 2023, 14:24:20 UTC

Expires: 30 Dec 2026, 14:24:20 UTC

Registrar: Cronon GmbH

Unlock store depth for Velthentic

Social ad creatives, SEO sources, search demand and Meta advertiser depth — the full picture behind this store's numbers.

  • · SEO & traffic source breakdown

GoogleMetaAdvertising signals

Google Shopping, Meta Ad Library, keyword visibility and Ads Transparency signals — estimated visibility, never exact ad spend.

Store overview

Classification, markets, ranking and product detail from Store Leads — estimates, not a complete audit.

Classification

Categories

Apparel › Footwear

Tags

Dropshipper

Features

Shopify Online Store 2.0International ShippingNew Shopify Checkout (2022)Contact PageTracking or ReturnsTracking Page

Markets & shipping

Ships to / sells in

ADAEAFAGAIALAMAOARATAUAWAXAZBABBBDBEBFBGBHBIBJBLBMBNBQBRBSBTBWBYBZCACCCFCGCHCICKCLCMCNCOCRCWCXCYCZDEDJDKDMDODZECEEEGERESETFIFJFOFRGAGBGDGEGFGGGHGIGLGMGNGPGQGRGSGTGWGYHKHNHRHTHUIDIEILIMINIOIQISITJEJMJOJPKEKGKHKIKMKNKWKYKZLALBLCLILKLRLSLTLULVLYMAMCMEMFMGMLMMMNMOMQMRMSMTMUMVMWMXMYMZNANCNENFNGNINLNONPNRNUNZOMPAPEPFPGPHPKPLPMPNPTPYQARORSRURWSASBSCSDSESGSISJSKSLSMSNSOSRSSSTSVSXTCTDTFTGTHTJTKTLTMTNTOTRTTTVTWUAUGUMUSUYUZVCVNVUWFWSXKYEYTZAZMZW

Shipping carriers

Australia PostUSPSCanada Post
Est. yearly sales
$1M – $2M
estimated annualized
Shopify rank
#540,142
global
Outranks
86.7%
of Shopify stores
Overall rank
#1,864,571
all platforms
Outranks
87.4%
of all tracked stores
Monthly app spend
$4
est.
Related domains
1
Variants
14,825
Vendors
1
Collections
30
Avg. price (USD)
$57.48
Min price (USD)
$5.95
Max price (USD)
$4,399.00
Location
Paphos, Europe
Subregion
Eastern Europe
Plan
Shopify Plus
Theme
impact (Maestrooo)
shape · v4.3.4 · $400 theme
Trustpilot
3.0 / 5
367 reviews
Avg. product weight
484 g
estimated — shipping cost proxy
New product images
28
last 30d · 189 in 90d
Newest product
Sep 5, 2026
last product Store Leads saw published
Storefront languages
EN
site language
Est. store created
Jan 5, 2024
SL last updated
Sep 15, 2026

Platform stack

Social profiles, installed apps and technologies Store Leads associates with this storefront.

Social media

Installed apps (9)

17TRACK Order Tracking

17TRACK Order Tracking

order tracking · shipping

Aftersell Post Purchase Upsell

Aftersell Post Purchase Upsell

upsell and cross-sell · checkout - other

DSers: Dropship+AliExpress+AI

DSers: Dropship+AliExpress+AI

dropshipping

Kiwi Size Chart & Recommender

Kiwi Size Chart & Recommender

product comparison · product variants

Klarna On‑Site Messaging

Klarna On‑Site Messaging

banners · advertising - other

CWILL Order Tracking

CWILL Order Tracking

order tracking · shipping

Urgency Bear Countdown Timer

Urgency Bear Countdown Timer

countdown timer · stock alerts

Pumper Bundles Quantity Breaks

Pumper Bundles Quantity Breaks

discounts · product bundles

+1 more apps on file

Technologies detected

Estimated technographics — not a complete audit.

Apple PayArriveCloudflareCloudflare CDNFacebook PixelGoogle Ads PixelGoogle AdsenseGoogle PayKlarnaParcelPanelPayPal Express CheckoutPinterest PixelShop PayVimeoYouTube PlayerreCAPTCHA

Quick answers about Velthentic

Figures are estimates from public data — never exact sales or revenue.

Is Velthentic a dropshipping store?
Probably. velthentic.com is a strong dropshipping match on WHAT Shipping?. We found DSers, Parcel Panel / ParcelWILL and 17TRACK installed. The match comes from the apps the store runs, not proof of how it fulfils orders.
How much traffic does Velthentic get?
An estimated 5K–10K visits a month. This is an estimate from public data, not the store's own analytics.
How much does Velthentic sell?
An estimated $92K – $172K in sales a month ($1M – $2M a year). It is a range estimated from public data, not reported revenue.
What does Velthentic sell?
velthentic.com lists about 723 products in Apparel › Footwear. Its likely best sellers are Logan Suede Slides, Haru Cotton Stripe Shirt and Ranger Quarter-Zip Hoodie.
What apps does Velthentic use?
WHAT Shipping? found 9 apps on velthentic.com, including 17TRACK Order Tracking, Aftersell Post Purchase Upsell, DSers: Dropship+AliExpress+AI, Kiwi Size Chart & Recommender and Klarna On‑Site Messaging.
How old is Velthentic?
velthentic.com was created around Jan 5, 2024, about 2 yr 8 mo ago, by Store Leads' estimate.